PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.0534s0039.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family ZF-HD
Protein Properties Length: 317aa    MW: 35268.5 Da    PI: 7.9835
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.0534s0039.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer103.61.3e-3286141460
          ZF-HD_dimer   4 vrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 
                          ++YkeClkNhAas+Gg+a+DGCgEfmps ge+g+++al+C+AC+CHRnFHRreve e
  Cagra.0534s0039.1.p  86 IKYKECLKNHAASMGGNAIDGCGEFMPS-GEDGSIEALTCSACNCHRNFHRREVEGE 141
                          79*************************9.999*********************9865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047701.6E-2986138IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257746.0E-2786148IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015667.7E-3287138IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.82288137IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466891.32E-20213286IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.0E-31219287IPR009057Homeodomain-like
PROSITE profilePS500718.519223287IPR001356Homeobox domain
TIGRFAMsTIGR015657.0E-27225281IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MEIASQEDPT PINISYGNTG GGHGNMIHHH HANSAPSALN ITSPNPLLVS SNGNGLAKTH  60
DHSHHHHHVG YNIMFNNIKK EKPVVIKYKE CLKNHAASMG GNAIDGCGEF MPSGEDGSIE  120
ALTCSACNCH RNFHRREVEG EEKTFFSPYL NNHQPPPLQR KLMFHHKMVK SPSPQQMIMP  180
IGVATAGSNS ESEDLMEEDG GGSLTFRQPQ PPPPPPPYSY GHNQRKRFRT KFTQEQKEKM  240
VSFAERVGWK MQRQEESAVQ EFCQEIGIRR RVLKVWMHNN KHNLSKKNNN VELSAGNTDV  300
NNATTEDLAS TSPILS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A7e-242262831875ZF-HD homeobox family protein
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00258DAPTransfer from AT2G02540Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0041360.0AC004136.3 Arabidopsis thaliana chromosome 2 BAC T8K22 genomic sequence, complete sequence.
GenBankAY0915150.0AY091515.1 Arabidopsis thaliana hypothetical protein At2g02540/T822.16 mRNA, complete cds.
GenBankAY7738340.0AY773834.1 Arabidopsis thaliana clone pENTR221-At2g02540 hypothetical protein (At2g02540) mRNA, complete cds.
GenBankCP0026850.0CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006291509.10.0hypothetical protein CARUB_v10017657mg
SwissprotO647221e-174ZHD3_ARATH; Zinc-finger homeodomain protein 3
TrEMBLR0FPG30.0R0FPG3_9BRAS; Uncharacterized protein
STRINGAT2G02540.11e-172(Arabidopsis thaliana)
STRINGfgenesh2_kg.5__158__AT2G02540.11e-172(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM33392665
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02540.11e-162homeobox protein 21